![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (7 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
![]() | Domain d3sdxd_: 3sdx D: [249376] Other proteins in same PDB: d3sdxa1, d3sdxa2, d3sdxa3, d3sdxc1, d3sdxc2, d3sdxe1, d3sdxe2, d3sdxf1, d3sdxf2, d3sdxg1, d3sdxg2, d3sdxh1, d3sdxh2 automated match to d1k5nb_ complexed with gcy |
PDB Entry: 3sdx (more details), 3.12 Å
SCOPe Domain Sequences for d3sdxd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sdxd_ b.1.1.2 (D:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdr
Timeline for d3sdxd_: