SCOPe 2.07: Domain d3sdxc2: 3sdx C:184-277

Lineage for d3sdxc2 (3sdx C:184-277)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d3sdxc2: 3sdx C:184-277 [249375]
   Other proteins in same PDB: d3sdxa1, d3sdxa3, d3sdxb_, d3sdxc1, d3sdxd_, d3sdxe2, d3sdxg2
   automated match to d3hujc2
   complexed with gcy

Details for d3sdxc2

PDB Entry: 3sdx, 3.12 Å

PDB Description: Crystal structure of human autoreactive-Valpha24 NKT TCR in complex with CD1d-beta-galactosylceramide

PDB Compounds: (C:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d3sdxc2:

Sequence, based on SEQRES records:

>d3sdxc2 b.1.1.0 (C:184-277) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlyw

Sequence, based on observed residues (ATOM records):

>d3sdxc2 b.1.1.0 (C:184-277) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvagescrvkhsslegqdivlyw

Timeline for d3sdxc2:

• d3sdxc2 first appeared in SCOPe 2.04
  
• d3sdxc2 appears in SCOPe 2.06
  
• d3sdxc2 appears in the current release, SCOPe 2.08