Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species) Class I MHC-related |
Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (13 PDB entries) |
Domain d3sdxa1: 3sdx A:6-183 [249371] Other proteins in same PDB: d3sdxa2, d3sdxa3, d3sdxb_, d3sdxc2, d3sdxd_, d3sdxe1, d3sdxe2, d3sdxf1, d3sdxf2, d3sdxg1, d3sdxg2, d3sdxh1, d3sdxh2 automated match to d3hujc1 complexed with gcy |
PDB Entry: 3sdx (more details), 3.12 Å
SCOPe Domain Sequences for d3sdxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sdxa1 d.19.1.1 (A:6-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]} rlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwet lqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdils fqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk
Timeline for d3sdxa1: