Lineage for d3sdxa1 (3sdx A:6-183)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897194Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 1897199Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (11 PDB entries)
  8. 1897211Domain d3sdxa1: 3sdx A:6-183 [249371]
    Other proteins in same PDB: d3sdxa2, d3sdxb_, d3sdxc2, d3sdxd_, d3sdxe1, d3sdxe2, d3sdxf1, d3sdxf2, d3sdxg1, d3sdxg2, d3sdxh1, d3sdxh2
    automated match to d3hujc1
    complexed with gcy

Details for d3sdxa1

PDB Entry: 3sdx (more details), 3.12 Å

PDB Description: Crystal structure of human autoreactive-Valpha24 NKT TCR in complex with CD1d-beta-galactosylceramide
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d3sdxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdxa1 d.19.1.1 (A:6-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
rlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwet
lqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdils
fqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk

SCOPe Domain Coordinates for d3sdxa1:

Click to download the PDB-style file with coordinates for d3sdxa1.
(The format of our PDB-style files is described here.)

Timeline for d3sdxa1: