SCOPe 2.07: Domain d3sdga2: 3sdg A:98-214

Lineage for d3sdga2 (3sdg A:98-214)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Ethr repressor [109978] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [109979] (65 PDB entries)
   Uniprot P96222 22-215

8. Domain d3sdga2: 3sdg A:98-214 [249370]
   Other proteins in same PDB: d3sdga1
   automated match to d3sfia2
   protein/DNA complex; complexed with 3se

Details for d3sdga2

PDB Entry: 3sdg, 1.87 Å

PDB Description: ethionamide boosters part 2: combining bioisosteric replacement and structure-based drug design to solve pharmacokinetic issues in a series of potent 1,2,4-oxadiazole ethr inhibitors.

PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d3sdga2:

Sequence; same for both SEQRES and ATOM records:

>d3sdga2 a.121.1.1 (A:98-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
drenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavidaer
drgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

Timeline for d3sdga2:

• d3sdga2 first appeared in SCOPe 2.04
  
• d3sdga2 appears in SCOPe 2.06
  
• d3sdga2 appears in the current release, SCOPe 2.08