Lineage for d3sddd2 (3sdd D:120-242)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517994Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)
  8. 1518479Domain d3sddd2: 3sdd D:120-242 [249368]
    Other proteins in same PDB: d3sdda1, d3sdda2, d3sddb_, d3sddc1, d3sddd1
    automated match to d3of6b2
    complexed with 3gd, nag

Details for d3sddd2

PDB Entry: 3sdd (more details), 3 Å

PDB Description: Crystal structure of autoreactive-Valpha14-Vbeta6 NKT TCR in complex with CD1d-beta-lactosylceramide
PDB Compounds: (D:) NKT TCR autoreactive-Vbeta6 chain

SCOPe Domain Sequences for d3sddd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sddd2 b.1.1.2 (D:120-242) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aea

SCOPe Domain Coordinates for d3sddd2:

Click to download the PDB-style file with coordinates for d3sddd2.
(The format of our PDB-style files is described here.)

Timeline for d3sddd2: