SCOPe 2.07: Domain d3sddc2: 3sdd C:118-203

Lineage for d3sddc2 (3sdd C:118-203)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d3sddc2: 3sdd C:118-203 [249366]
   Other proteins in same PDB: d3sdda1, d3sdda2, d3sdda3, d3sddb_, d3sddc1, d3sddd1
   automated match to d4eura2
   complexed with 3gd, nag

Details for d3sddc2

PDB Entry: 3sdd, 3 Å

PDB Description: crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-beta-lactosylceramide

PDB Compounds: (C:) NKT TCR Valpha14 chain

SCOPe Domain Sequences for d3sddc2:

Sequence, based on SEQRES records:

>d3sddc2 b.1.1.2 (C:118-203) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtf

Sequence, based on observed residues (ATOM records):

>d3sddc2 b.1.1.2 (C:118-203) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdsksclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaws
canafnnsiipedtf

Timeline for d3sddc2:

• d3sddc2 first appeared in SCOPe 2.04
  
• d3sddc2 appears in SCOPe 2.06
  
• d3sddc2 appears in the current release, SCOPe 2.08