Lineage for d3sddc2 (3sdd C:118-203)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753084Domain d3sddc2: 3sdd C:118-203 [249366]
    Other proteins in same PDB: d3sdda1, d3sdda2, d3sdda3, d3sddb_, d3sddc1, d3sddd1
    automated match to d4eura2
    complexed with 3gd, nag

Details for d3sddc2

PDB Entry: 3sdd (more details), 3 Å

PDB Description: crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-beta-lactosylceramide
PDB Compounds: (C:) NKT TCR Valpha14 chain

SCOPe Domain Sequences for d3sddc2:

Sequence, based on SEQRES records: (download)

>d3sddc2 b.1.1.2 (C:118-203) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtf

Sequence, based on observed residues (ATOM records): (download)

>d3sddc2 b.1.1.2 (C:118-203) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdsksclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaws
canafnnsiipedtf

SCOPe Domain Coordinates for d3sddc2:

Click to download the PDB-style file with coordinates for d3sddc2.
(The format of our PDB-style files is described here.)

Timeline for d3sddc2: