![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (19 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries) |
![]() | Domain d3sdda2: 3sdd A:186-295 [249363] Other proteins in same PDB: d3sdda1, d3sddb_, d3sddc2, d3sddd2 automated match to d4f7ca2 complexed with 3gd, nag |
PDB Entry: 3sdd (more details), 3 Å
SCOPe Domain Sequences for d3sdda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sdda2 b.1.1.0 (A:186-295) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw ylqatldveageeaglacrvkhsslggqdiilywgslhhildaqkmvwnh
Timeline for d3sdda2: