Lineage for d3sdda1 (3sdd A:6-185)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938889Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)
  8. 2938964Domain d3sdda1: 3sdd A:6-185 [249362]
    Other proteins in same PDB: d3sdda2, d3sdda3, d3sddb_, d3sddc1, d3sddc2, d3sddd1, d3sddd2
    automated match to d4f7ca1
    complexed with 3gd, nag

Details for d3sdda1

PDB Entry: 3sdd (more details), 3 Å

PDB Description: crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-beta-lactosylceramide
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3sdda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdda1 d.19.1.0 (A:6-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek
lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv
vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d3sdda1:

Click to download the PDB-style file with coordinates for d3sdda1.
(The format of our PDB-style files is described here.)

Timeline for d3sdda1: