Lineage for d3sdcd2 (3sdc D:120-243)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2363630Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
  8. 2364469Domain d3sdcd2: 3sdc D:120-243 [249361]
    Other proteins in same PDB: d3sdca1, d3sdca2, d3sdca3, d3sdcb_, d3sdcc1, d3sdcd1
    automated match to d3of6b2
    complexed with 3gb, nag

Details for d3sdcd2

PDB Entry: 3sdc (more details), 3.1 Å

PDB Description: crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-globotrihexosylceramide
PDB Compounds: (D:) NKT TCR autoreactive-Vbeta6 chain

SCOPe Domain Sequences for d3sdcd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdcd2 b.1.1.2 (D:120-243) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeaw

SCOPe Domain Coordinates for d3sdcd2:

Click to download the PDB-style file with coordinates for d3sdcd2.
(The format of our PDB-style files is described here.)

Timeline for d3sdcd2: