Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries) |
Domain d3sdcd2: 3sdc D:120-243 [249361] Other proteins in same PDB: d3sdca1, d3sdca2, d3sdca3, d3sdcb_, d3sdcc1, d3sdcd1 automated match to d3of6b2 complexed with 3gb, nag |
PDB Entry: 3sdc (more details), 3.1 Å
SCOPe Domain Sequences for d3sdcd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sdcd2 b.1.1.2 (D:120-243) automated matches {Mouse (Mus musculus) [TaxId: 10090]} lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs aeaw
Timeline for d3sdcd2: