| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
| Domain d3sdcc2: 3sdc C:118-204 [249359] Other proteins in same PDB: d3sdca1, d3sdca2, d3sdca3, d3sdcb_, d3sdcc1, d3sdcd1 automated match to d4eura2 complexed with 3gb, nag |
PDB Entry: 3sdc (more details), 3.1 Å
SCOPe Domain Sequences for d3sdcc2:
Sequence, based on SEQRES records: (download)
>d3sdcc2 b.1.1.2 (C:118-204) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtff
>d3sdcc2 b.1.1.2 (C:118-204) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsava
wsacanafnnipedtff
Timeline for d3sdcc2: