Lineage for d3sdcc1 (3sdc C:1-117)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520466Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)
  8. 1521097Domain d3sdcc1: 3sdc C:1-117 [249358]
    Other proteins in same PDB: d3sdca1, d3sdcb_, d3sdcc2, d3sdcd2
    automated match to d4eura1
    complexed with 3gb, nag

Details for d3sdcc1

PDB Entry: 3sdc (more details), 3.1 Å

PDB Description: crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-globotrihexosylceramide
PDB Compounds: (C:) NKT TCR Valpha14 chain

SCOPe Domain Sequences for d3sdcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdcc1 b.1.1.0 (C:1-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqveqspqslvvrqgensvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

SCOPe Domain Coordinates for d3sdcc1:

Click to download the PDB-style file with coordinates for d3sdcc1.
(The format of our PDB-style files is described here.)

Timeline for d3sdcc1: