SCOPe 2.04: Domain d3sdca1: 3sdc A:7-185

Lineage for d3sdca1 (3sdc A:7-185)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (31 PDB entries)

8. Domain d3sdca1: 3sdc A:7-185 [249355]
   Other proteins in same PDB: d3sdca2, d3sdcb_, d3sdcc1, d3sdcc2, d3sdcd1, d3sdcd2
   automated match to d4f7ca1
   complexed with 3gb, nag

Details for d3sdca1

PDB Entry: 3sdc, 3.1 Å

PDB Description: crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-globotrihexosylceramide

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3sdca1:

Sequence; same for both SEQRES and ATOM records:

>d3sdca1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d3sdca1:

• d3sdca1 is new in SCOPe 2.04-stable
  
• d3sdca1 appears in SCOPe 2.05
  
• d3sdca1 appears in the current release, SCOPe 2.07