SCOPe 2.06: Domain d3sclf_: 3scl F:

Lineage for d3sclf_ (3scl F:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
   core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542

4. Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family)
   automatically mapped to Pfam PF09408

5. Family d.318.1.1: SARS receptor-binding domain-like [143588] (2 proteins)
   part of PfamB PB000266

6. Protein automated matches [254724] (1 species)
   not a true protein

7. Species SARS coronavirus [TaxId:227859] [256080] (4 PDB entries)

8. Domain d3sclf_: 3scl F: [249354]
   Other proteins in same PDB: d3scla_, d3sclb_
   automated match to d2ghwa_
   complexed with cl, zn

Details for d3sclf_

PDB Entry: 3scl, 3 Å

PDB Description: crystal structure of spike protein receptor-binding domain from sars coronavirus epidemic strain complexed with human-civet chimeric receptor ace2

PDB Compounds: (F:) Spike glycoprotein

SCOPe Domain Sequences for d3sclf_:

Sequence, based on SEQRES records:

>d3sclf_ d.318.1.1 (F:) automated matches {SARS coronavirus [TaxId: 227859]}
pfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcfsnvy
adsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyryl
rhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvlsfe

Sequence, based on observed residues (ATOM records):

>d3sclf_ d.318.1.1 (F:) automated matches {SARS coronavirus [TaxId: 227859]}
pfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklnvyadsfvv
kgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyrylrhgklr
pferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvlsfe

Timeline for d3sclf_:

• d3sclf_ first appeared in SCOPe 2.04
  
• d3sclf_ appears in SCOPe 2.05
  
• d3sclf_ appears in SCOPe 2.07
  
• d3sclf_ appears in the current release, SCOPe 2.08