Lineage for d3sclf_ (3scl F:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1689021Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
    core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542
  4. 1689022Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) (S)
    automatically mapped to Pfam PF09408
  5. 1689023Family d.318.1.1: SARS receptor-binding domain-like [143588] (2 proteins)
    part of PfamB PB000266
  6. 1689041Protein automated matches [254724] (1 species)
    not a true protein
  7. 1689042Species SARS coronavirus [TaxId:227859] [256080] (4 PDB entries)
  8. 1689048Domain d3sclf_: 3scl F: [249354]
    Other proteins in same PDB: d3scla_, d3sclb_
    automated match to d2ghwa_
    complexed with cl, zn

Details for d3sclf_

PDB Entry: 3scl (more details), 3 Å

PDB Description: crystal structure of spike protein receptor-binding domain from sars coronavirus epidemic strain complexed with human-civet chimeric receptor ace2
PDB Compounds: (F:) Spike glycoprotein

SCOPe Domain Sequences for d3sclf_:

Sequence, based on SEQRES records: (download)

>d3sclf_ d.318.1.1 (F:) automated matches {SARS coronavirus [TaxId: 227859]}
pfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcfsnvy
adsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyryl
rhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvlsfe

Sequence, based on observed residues (ATOM records): (download)

>d3sclf_ d.318.1.1 (F:) automated matches {SARS coronavirus [TaxId: 227859]}
pfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklnvyadsfvv
kgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyrylrhgklr
pferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvlsfe

SCOPe Domain Coordinates for d3sclf_:

Click to download the PDB-style file with coordinates for d3sclf_.
(The format of our PDB-style files is described here.)

Timeline for d3sclf_: