Lineage for d3sclf_ (3scl F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010708Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
    core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542
  4. 3010709Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) (S)
    automatically mapped to Pfam PF09408
  5. 3010710Family d.318.1.1: SARS receptor-binding domain-like [143588] (2 proteins)
    part of PfamB PB000266
  6. 3010711Protein Spike protein S1 [143589] (5 species)
  7. 3010719Species SARS coronavirus [TaxId:227859] [143590] (14 PDB entries)
    Uniprot P59594 320-502! Uniprot P59594 321-512! Uniprot P59594 323-502
  8. 3010743Domain d3sclf_: 3scl F: [249354]
    Other proteins in same PDB: d3scla_, d3sclb_
    automated match to d2ghwa_
    complexed with cl, zn

Details for d3sclf_

PDB Entry: 3scl (more details), 3 Å

PDB Description: crystal structure of spike protein receptor-binding domain from sars coronavirus epidemic strain complexed with human-civet chimeric receptor ace2
PDB Compounds: (F:) Spike glycoprotein

SCOPe Domain Sequences for d3sclf_:

Sequence, based on SEQRES records: (download)

>d3sclf_ d.318.1.1 (F:) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
pfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcfsnvy
adsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyryl
rhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvlsfe

Sequence, based on observed residues (ATOM records): (download)

>d3sclf_ d.318.1.1 (F:) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
pfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklnvyadsfvv
kgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyrylrhgklr
pferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvlsfe

SCOPe Domain Coordinates for d3sclf_:

Click to download the PDB-style file with coordinates for d3sclf_.
(The format of our PDB-style files is described here.)

Timeline for d3sclf_: