Lineage for d3scke_ (3sck E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616505Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
    core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542
  4. 2616506Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) (S)
    automatically mapped to Pfam PF09408
  5. 2616507Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein)
    part of PfamB PB000266
  6. 2616508Protein Spike protein S1 [143589] (4 species)
  7. 2616514Species SARS coronavirus [TaxId:227859] [143590] (14 PDB entries)
    Uniprot P59594 320-502! Uniprot P59594 321-512! Uniprot P59594 323-502
  8. 2616537Domain d3scke_: 3sck E: [249349]
    Other proteins in same PDB: d3scka_, d3sckb_
    automated match to d3d0ie_
    complexed with cl, zn

Details for d3scke_

PDB Entry: 3sck (more details), 3 Å

PDB Description: crystal structure of spike protein receptor-binding domain from a predicted sars coronavirus civet strain complexed with human-civet chimeric receptor ace2
PDB Compounds: (E:) Spike glycoprotein

SCOPe Domain Sequences for d3scke_:

Sequence, based on SEQRES records: (download)

>d3scke_ d.318.1.1 (E:) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
pfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcfsnvy
adsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyryl
rhgklrpferdisnvpfspdgkpctppapncywplrgygfytttgigyqpyrvvvlsfe

Sequence, based on observed residues (ATOM records): (download)

>d3scke_ d.318.1.1 (E:) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
pfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklnvyadsfvv
kgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyrylrhgklr
pferdisnvpfspdgkpctppapncywplrgygfytttgigyqpyrvvvlsfe

SCOPe Domain Coordinates for d3scke_:

Click to download the PDB-style file with coordinates for d3scke_.
(The format of our PDB-style files is described here.)

Timeline for d3scke_: