Lineage for d3scje_ (3scj E:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1689021Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
    core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542
  4. 1689022Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) (S)
    automatically mapped to Pfam PF09408
  5. 1689023Family d.318.1.1: SARS receptor-binding domain-like [143588] (2 proteins)
    part of PfamB PB000266
  6. 1689041Protein automated matches [254724] (1 species)
    not a true protein
  7. 1689042Species SARS coronavirus [TaxId:227859] [256080] (4 PDB entries)
  8. 1689045Domain d3scje_: 3scj E: [249345]
    Other proteins in same PDB: d3scja_, d3scjb_
    automated match to d2ghwc_
    complexed with cl, zn

Details for d3scje_

PDB Entry: 3scj (more details), 3 Å

PDB Description: crystal structure of spike protein receptor-binding domain from a predicted sars coronavirus civet strain complexed with human receptor ace2
PDB Compounds: (E:) Spike glycoprotein

SCOPe Domain Sequences for d3scje_:

Sequence, based on SEQRES records: (download)

>d3scje_ d.318.1.1 (E:) automated matches {SARS coronavirus [TaxId: 227859]}
cpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcfsnv
yadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyry
lrhgklrpferdisnvpfspdgkpctppapncywplrgygfytttgigyqpyrvvvlsfe

Sequence, based on observed residues (ATOM records): (download)

>d3scje_ d.318.1.1 (E:) automated matches {SARS coronavirus [TaxId: 227859]}
cpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklnvyadsfv
vkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyrylrhgkl
rpferdisnvpfspdgkpctppapncywplrgygfytttgigyqpyrvvvlsfe

SCOPe Domain Coordinates for d3scje_:

Click to download the PDB-style file with coordinates for d3scje_.
(The format of our PDB-style files is described here.)

Timeline for d3scje_: