Lineage for d3scgb1 (3scg B:6-76)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1488831Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1488832Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1488929Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. 1488940Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species)
  7. 1488941Species Streptomyces wedmorensis [TaxId:43759] [140517] (14 PDB entries)
    Uniprot Q56185 6-76
  8. 1488968Domain d3scgb1: 3scg B:6-76 [249339]
    Other proteins in same PDB: d3scga2, d3scgb2, d3scgc2
    automated match to d1zzcb1
    complexed with fe2, tb6

Details for d3scgb1

PDB Entry: 3scg (more details), 3 Å

PDB Description: Fe(II)-HppE with R-HPP
PDB Compounds: (B:) epoxidase

SCOPe Domain Sequences for d3scgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3scgb1 a.35.1.3 (B:6-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
sigaltppagn

SCOPe Domain Coordinates for d3scgb1:

Click to download the PDB-style file with coordinates for d3scgb1.
(The format of our PDB-style files is described here.)

Timeline for d3scgb1: