Class a: All alpha proteins [46456] (285 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.3: SinR domain-like [47432] (9 proteins) |
Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species) |
Species Streptomyces wedmorensis [TaxId:43759] [140517] (14 PDB entries) Uniprot Q56185 6-76 |
Domain d3scgb1: 3scg B:6-76 [249339] Other proteins in same PDB: d3scga2, d3scgb2, d3scgc2 automated match to d1zzcb1 complexed with fe2, tb6 |
PDB Entry: 3scg (more details), 3 Å
SCOPe Domain Sequences for d3scgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3scgb1 a.35.1.3 (B:6-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt sigaltppagn
Timeline for d3scgb1:
View in 3D Domains from other chains: (mouse over for more information) d3scga1, d3scga2, d3scgc1, d3scgc2 |