Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.129: MCP/YpsA-like [102404] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567 |
Superfamily c.129.1: MCP/YpsA-like [102405] (3 families) |
Family c.129.1.0: automated matches [233357] (1 protein) not a true family |
Protein automated matches [233358] (2 species) not a true protein |
Species Mycobacterium marinum [TaxId:216594] [256079] (1 PDB entry) |
Domain d3sbxd_: 3sbx D: [249332] automated match to d3quaa_ complexed with amp |
PDB Entry: 3sbx (more details), 2.5 Å
SCOPe Domain Sequences for d3sbxd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sbxd_ c.129.1.0 (D:) automated matches {Mycobacterium marinum [TaxId: 216594]} rwtvavycaaapthpellelagavgaaiaargwtlvwggghvsamgavssaarahggwtv gvipkmlvhreladhdadelvvtetmwerkqvmedranafitlpggvgtldelldvwteg ylgmhdksivvldpwghfdglrawlseladtgyvsrtamerlivvdnlddalqacap
Timeline for d3sbxd_: