![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.129: MCP/YpsA-like [102404] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567 |
![]() | Superfamily c.129.1: MCP/YpsA-like [102405] (6 families) ![]() |
![]() | Family c.129.1.0: automated matches [233357] (1 protein) not a true family |
![]() | Protein automated matches [233358] (8 species) not a true protein |
![]() | Species Mycobacterium marinum [TaxId:216594] [256079] (1 PDB entry) |
![]() | Domain d3sbxa_: 3sbx A: [249329] automated match to d3quaa_ complexed with amp |
PDB Entry: 3sbx (more details), 2.5 Å
SCOPe Domain Sequences for d3sbxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sbxa_ c.129.1.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]} rwtvavycaaapthpellelagavgaaiaargwtlvwggghvsamgavssaarahggwtv gvipkmlvhreladhdadelvvtetmwerkqvmedranafitlpggvgtldelldvwteg ylgmhdksivvldpwghfdglrawlseladtgyvsrtamerlivvdnlddalqacap
Timeline for d3sbxa_: