Lineage for d3sbxa_ (3sbx A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922906Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567
  4. 2922907Superfamily c.129.1: MCP/YpsA-like [102405] (6 families) (S)
  5. 2922991Family c.129.1.0: automated matches [233357] (1 protein)
    not a true family
  6. 2922992Protein automated matches [233358] (8 species)
    not a true protein
  7. 2923013Species Mycobacterium marinum [TaxId:216594] [256079] (1 PDB entry)
  8. 2923014Domain d3sbxa_: 3sbx A: [249329]
    automated match to d3quaa_
    complexed with amp

Details for d3sbxa_

PDB Entry: 3sbx (more details), 2.5 Å

PDB Description: crystal structure of a putative uncharacterized protein from mycobacterium marinum bound to adenosine 5'-monophosphate amp
PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3sbxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sbxa_ c.129.1.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]}
rwtvavycaaapthpellelagavgaaiaargwtlvwggghvsamgavssaarahggwtv
gvipkmlvhreladhdadelvvtetmwerkqvmedranafitlpggvgtldelldvwteg
ylgmhdksivvldpwghfdglrawlseladtgyvsrtamerlivvdnlddalqacap

SCOPe Domain Coordinates for d3sbxa_:

Click to download the PDB-style file with coordinates for d3sbxa_.
(The format of our PDB-style files is described here.)

Timeline for d3sbxa_: