![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
![]() | Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) ![]() contains a helix-two turns-helix (H2TH) motif |
![]() | Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins) contains 4 helices in the core |
![]() | Protein DNA repair protein MutM (Fpg) [81620] (4 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [81611] (23 PDB entries) |
![]() | Domain d3sata2: 3sat A:135-216 [249322] Other proteins in same PDB: d3sata1, d3sata3 automated match to d1r2za1 protein/DNA complex; complexed with gol, zn; mutant |
PDB Entry: 3sat (more details), 2.15 Å
SCOPe Domain Sequences for d3sata2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sata2 a.156.1.2 (A:135-216) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} gpeplspafspavlaeravktkrsvkallldctvvagfgniyvdeslfragilpgrpaas lsskeierlheemvatigeavm
Timeline for d3sata2: