SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1lt6n_ (1lt6 N:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2050241Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2050242Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 protein domains)
  6. 2050366Protein Heat-labile toxin [50205] (2 species)
  7. 2050367Species Escherichia coli, type IB [TaxId:562] [50206] (21 PDB entries)
  8. 2050450Domain d1lt6n_: 1lt6 N: [24932]
    complexed with gaa

Details for d1lt6n_

PDB Entry: 1lt6 (more details), 2.2 Å

PDB Description: heat-labile enterotoxin b-pentamer complexed with metanitrophenylgalactoside
PDB Compounds: (N:) heat-labile enterotoxin

SCOPe Domain Sequences for d1lt6n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lt6n_ b.40.2.1 (N:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

SCOPe Domain Coordinates for d1lt6n_:

Click to download the PDB-style file with coordinates for d1lt6n_.
(The format of our PDB-style files is described here.)

Timeline for d1lt6n_: