| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) ![]() contains a helix-two turns-helix (H2TH) motif |
| Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins) contains 4 helices in the core |
| Protein DNA repair protein MutM (Fpg) [81620] (4 species) |
| Species Bacillus stearothermophilus [TaxId:1422] [81611] (23 PDB entries) |
| Domain d3sasa2: 3sas A:135-217 [249319] Other proteins in same PDB: d3sasa1, d3sasa3 automated match to d1r2za1 protein/DNA complex; complexed with zn; mutant |
PDB Entry: 3sas (more details), 2.05 Å
SCOPe Domain Sequences for d3sasa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sasa2 a.156.1.2 (A:135-217) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
gpeplspafspavlaeravktkrsvkallldctvvagfgniyvdeslfragilpgrpaas
lsskeierlheemvatigeavmk
Timeline for d3sasa2: