Lineage for d3sasa1 (3sas A:2-134)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1811963Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 1811964Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) (S)
    automatically mapped to Pfam PF01149
  5. 1811965Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins)
  6. 1811966Protein DNA repair protein MutM (Fpg) [81621] (4 species)
  7. 1811967Species Bacillus stearothermophilus [TaxId:1422] [81612] (23 PDB entries)
  8. 1811979Domain d3sasa1: 3sas A:2-134 [249318]
    Other proteins in same PDB: d3sasa2, d3sasa3
    automated match to d1r2za2
    protein/DNA complex; complexed with zn; mutant

Details for d3sasa1

PDB Entry: 3sas (more details), 2.05 Å

PDB Description: mutm slanted complex 4 with r112a mutation
PDB Compounds: (A:) DNA glycosylase

SCOPe Domain Sequences for d3sasa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sasa1 b.113.1.1 (A:2-134) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
pelpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvakfgtmhvya
keeadrrpplael

SCOPe Domain Coordinates for d3sasa1:

Click to download the PDB-style file with coordinates for d3sasa1.
(The format of our PDB-style files is described here.)

Timeline for d3sasa1: