SCOPe 2.05: Domain d3s82b2: 3s82 B:133-252

Lineage for d3s82b2 (3s82 B:133-252)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families)

5. Family d.130.1.0: automated matches [254267] (1 protein)
   not a true family

6. Protein automated matches [254617] (8 species)
   not a true protein

7. Species Mycobacterium avium [TaxId:243243] [256078] (1 PDB entry)

8. Domain d3s82b2: 3s82 B:133-252 [249314]
   automated match to d1rg9a2
   complexed with ca, edo, gol, unl

Details for d3s82b2

PDB Entry: 3s82, 1.73 Å

PDB Description: structure of a s-adenosylmethionine synthetase from mycobacterium avium

PDB Compounds: (B:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d3s82b2:

Sequence; same for both SEQRES and ATOM records:

>d3s82b2 d.130.1.0 (B:133-252) automated matches {Mycobacterium avium [TaxId: 243243]}
gdqglmfgyaindtpermplpialahrlsrrltevrkngvlpylrpdgktqvtiefeddv
pvrldtvvistqhaadidlentltpdirekvlntvlndlahdtldtsstrllvnptgkfv

Timeline for d3s82b2:

• d3s82b2 first appeared in SCOPe 2.04
  
• d3s82b2 appears in SCOPe 2.06
  
• d3s82b2 appears in the current release, SCOPe 2.08