![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
![]() | Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) ![]() |
![]() | Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
![]() | Protein automated matches [254617] (15 species) not a true protein |
![]() | Species Mycobacterium avium [TaxId:243243] [256078] (1 PDB entry) |
![]() | Domain d3s82a3: 3s82 A:253-403 [249312] automated match to d1mxaa3 complexed with ca, edo, gol, unl |
PDB Entry: 3s82 (more details), 1.73 Å
SCOPe Domain Sequences for d3s82a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s82a3 d.130.1.0 (A:253-403) automated matches {Mycobacterium avium [TaxId: 243243]} vggpmgdagltgrkiivdtyggwarhgggafsgkdpskvdrsaayamrwvaknivaagla ervevqvayaigkaapvglfietfgtatvdpvkiekivpevfdlrpgaiirdldllrpiy aqtaayghfgrtdvelpweqlnkvddlkrai
Timeline for d3s82a3: