SCOPe 2.04: Domain d3s7ga2: 3s7g A:340-443

Lineage for d3s7ga2 (3s7g A:340-443)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (9 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
Domain d3s7ga2: 3s7g A:340-443 [249303]
automated match to d1hzhh4

Details for d3s7ga2

PDB Entry: 3s7g (more details), 3.13 Å

PDB Description: Aglycosylated human igg1 fc fragment

PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d3s7ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s7ga2 b.1.1.2 (A:340-443) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

SCOPe Domain Coordinates for d3s7ga2:

Click to download the PDB-style file with coordinates for d3s7ga2.
(The format of our PDB-style files is described here.)

Timeline for d3s7ga2: