Lineage for d3s3za_ (3s3z A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1561414Fold b.89: Cyanovirin-N [51321] (1 superfamily)
    complex fold
  4. 1561415Superfamily b.89.1: Cyanovirin-N [51322] (2 families) (S)
    duplication: tandem repeat of two homologous motifs made three stranded beta-sheet and beta-hairpins
    automatically mapped to Pfam PF08881
  5. 1561416Family b.89.1.1: Cyanovirin-N [51323] (2 proteins)
  6. 1561454Protein automated matches [190774] (1 species)
    not a true protein
  7. 1561455Species Nostoc ellipsosporum [TaxId:45916] [188001] (8 PDB entries)
  8. 1561463Domain d3s3za_: 3s3z A: [249294]
    automated match to d3ezma_
    complexed with na

Details for d3s3za_

PDB Entry: 3s3z (more details), 1.75 Å

PDB Description: crystal structure an tandem cyanovirin-n dimer, cvn2l10
PDB Compounds: (A:) Tandem Cyanovirin-N Dimer CVN2L10

SCOPe Domain Sequences for d3s3za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s3za_ b.89.1.1 (A:) automated matches {Nostoc ellipsosporum [TaxId: 45916]}
grlgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqpsnfietc
rntqlagsselaaecktraqqfvstkinlddhianidgtlkyegg

SCOPe Domain Coordinates for d3s3za_:

Click to download the PDB-style file with coordinates for d3s3za_.
(The format of our PDB-style files is described here.)

Timeline for d3s3za_: