Lineage for d3s1ni1 (3s1n I:2-49)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641064Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families) (S)
  5. 2641065Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins)
  6. 2641144Protein automated matches [254700] (2 species)
    not a true protein
  7. 2641145Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255950] (4 PDB entries)
  8. 2641150Domain d3s1ni1: 3s1n I:2-49 [249280]
    Other proteins in same PDB: d3s1na_, d3s1nb_, d3s1ne1, d3s1ne2, d3s1nf_, d3s1nh_, d3s1nj_, d3s1nk_, d3s1nl_
    automated match to d1twfi1
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s1ni1

PDB Entry: 3s1n (more details), 3.1 Å

PDB Description: rna polymerase ii initiation complex with a 5-nt rna (variant 2)
PDB Compounds: (I:) DNA-directed RNA polymerase II subunit RPB9

SCOPe Domain Sequences for d3s1ni1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s1ni1 g.41.3.1 (I:2-49) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

SCOPe Domain Coordinates for d3s1ni1:

Click to download the PDB-style file with coordinates for d3s1ni1.
(The format of our PDB-style files is described here.)

Timeline for d3s1ni1: