Lineage for d3s1nh_ (3s1n H:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2060352Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
    duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10
    automatically mapped to Pfam PF03870
  6. 2060353Protein RNA polymerase subunit RBP8 [50322] (2 species)
  7. 2060354Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (35 PDB entries)
    Uniprot P20436
  8. 2060359Domain d3s1nh_: 3s1n H: [249279]
    Other proteins in same PDB: d3s1na_, d3s1nb_, d3s1ne1, d3s1ne2, d3s1nf_, d3s1ni1, d3s1ni2, d3s1nj_, d3s1nk_, d3s1nl_
    automated match to d1twfh_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s1nh_

PDB Entry: 3s1n (more details), 3.1 Å

PDB Description: rna polymerase ii initiation complex with a 5-nt rna (variant 2)
PDB Compounds: (H:) DNA-directed RNA polymerases I, II, and III subunit RPABC3

SCOPe Domain Sequences for d3s1nh_:

Sequence, based on SEQRES records: (download)

>d3s1nh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl
lmrlegnyrnlnnlkqenayllirr

Sequence, based on observed residues (ATOM records): (download)

>d3s1nh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln
nlkqenayllirr

SCOPe Domain Coordinates for d3s1nh_:

Click to download the PDB-style file with coordinates for d3s1nh_.
(The format of our PDB-style files is described here.)

Timeline for d3s1nh_: