Lineage for d3s1ne2 (3s1n E:144-215)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201058Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 2201059Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) (S)
    automatically mapped to Pfam PF01191
  5. 2201098Family d.78.1.0: automated matches [254302] (1 protein)
    not a true family
  6. 2201099Protein automated matches [254702] (3 species)
    not a true protein
  7. 2201100Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255952] (3 PDB entries)
  8. 2201101Domain d3s1ne2: 3s1n E:144-215 [249277]
    Other proteins in same PDB: d3s1na_, d3s1nb_, d3s1ne1, d3s1nf_, d3s1nh_, d3s1ni1, d3s1ni2, d3s1nj_, d3s1nk_, d3s1nl_
    automated match to d1dzfa2
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s1ne2

PDB Entry: 3s1n (more details), 3.1 Å

PDB Description: rna polymerase ii initiation complex with a 5-nt rna (variant 2)
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III subunit RPABC1

SCOPe Domain Sequences for d3s1ne2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s1ne2 d.78.1.0 (E:144-215) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOPe Domain Coordinates for d3s1ne2:

Click to download the PDB-style file with coordinates for d3s1ne2.
(The format of our PDB-style files is described here.)

Timeline for d3s1ne2: