| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) ![]() form homo and heterodimers |
| Family d.74.3.2: RBP11/RpoL [64311] (4 proteins) |
| Protein automated matches [190337] (2 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187160] (5 PDB entries) |
| Domain d3s1mk_: 3s1m K: [249272] Other proteins in same PDB: d3s1ma_, d3s1mb_, d3s1me1, d3s1me2, d3s1mf_, d3s1mh_, d3s1mi1, d3s1mi2, d3s1mj_, d3s1ml_ automated match to d1twfk_ protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 3s1m (more details), 3.13 Å
SCOPe Domain Sequences for d3s1mk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s1mk_ d.74.3.2 (K:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl
Timeline for d3s1mk_: