Class g: Small proteins [56992] (92 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) |
Family g.41.3.1: Transcriptional factor domain [57784] (5 proteins) |
Protein automated matches [254700] (2 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255950] (3 PDB entries) |
Domain d3s1mi1: 3s1m I:2-49 [249269] Other proteins in same PDB: d3s1ma_, d3s1mb_, d3s1me1, d3s1me2, d3s1mf_, d3s1mh_, d3s1mj_, d3s1mk_, d3s1ml_ automated match to d1twfi1 protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 3s1m (more details), 3.13 Å
SCOPe Domain Sequences for d3s1mi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s1mi1 g.41.3.1 (I:2-49) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli
Timeline for d3s1mi1: