SCOPe 2.05: Domain d3s1mi1: 3s1m I:2-49

Lineage for d3s1mi1 (3s1m I:2-49)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families)

5. Family g.41.3.1: Transcriptional factor domain [57784] (5 proteins)

6. Protein automated matches [254700] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255950] (3 PDB entries)

8. Domain d3s1mi1: 3s1m I:2-49 [249269]
   Other proteins in same PDB: d3s1ma_, d3s1mb_, d3s1me1, d3s1me2, d3s1mf_, d3s1mh_, d3s1mj_, d3s1mk_, d3s1ml_
   automated match to d1twfi1
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s1mi1

PDB Entry: 3s1m, 3.13 Å

PDB Description: rna polymerase ii initiation complex with a 5-nt rna (variant 1)

PDB Compounds: (I:) DNA-directed RNA polymerase II subunit RPB9

SCOPe Domain Sequences for d3s1mi1:

Sequence; same for both SEQRES and ATOM records:

>d3s1mi1 g.41.3.1 (I:2-49) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

Timeline for d3s1mi1:

• d3s1mi1 first appeared in SCOPe 2.04
  
• d3s1mi1 appears in SCOPe 2.06
  
• d3s1mi1 appears in the current release, SCOPe 2.08