Lineage for d3s1mh_ (3s1m H:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399889Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
    duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10
    automatically mapped to Pfam PF03870
  6. 2399890Protein RNA polymerase subunit RBP8 [50322] (2 species)
  7. 2399891Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (36 PDB entries)
    Uniprot P20436
  8. 2399909Domain d3s1mh_: 3s1m H: [249268]
    Other proteins in same PDB: d3s1ma_, d3s1mb_, d3s1me1, d3s1me2, d3s1mf_, d3s1mi1, d3s1mi2, d3s1mj_, d3s1mk_, d3s1ml_
    automated match to d1twfh_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s1mh_

PDB Entry: 3s1m (more details), 3.13 Å

PDB Description: rna polymerase ii initiation complex with a 5-nt rna (variant 1)
PDB Compounds: (H:) DNA-directed RNA polymerases I, II, and III subunit RPABC3

SCOPe Domain Sequences for d3s1mh_:

Sequence, based on SEQRES records: (download)

>d3s1mh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl
lmrlegnyrnlnnlkqenayllirr

Sequence, based on observed residues (ATOM records): (download)

>d3s1mh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln
nlkqenayllirr

SCOPe Domain Coordinates for d3s1mh_:

Click to download the PDB-style file with coordinates for d3s1mh_.
(The format of our PDB-style files is described here.)

Timeline for d3s1mh_: