Lineage for d3s12a1 (3s12 A:11-323)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040355Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2040579Domain d3s12a1: 3s12 A:11-323 [249261]
    Other proteins in same PDB: d3s12a2, d3s12b_
    automated match to d3gbna_
    complexed with nag, so4

Details for d3s12a1

PDB Entry: 3s12 (more details), 3.1 Å

PDB Description: Crystal structure of H5N1 influenza virus hemagglutinin, strain YU562 crystal form 1
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d3s12a1:

Sequence, based on SEQRES records: (download)

>d3s12a1 b.19.1.2 (A:11-323) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekaspandlcypgdfndyeelkhllsrinhfekiqiipks
swsnheassgvssacpylgkssffrnvvwlikknsayptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnt

Sequence, based on observed residues (ATOM records): (download)

>d3s12a1 b.19.1.2 (A:11-323) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdnvpewsyivekaspandlcypgdfndyeelkhllsrinhfekiqiipkssws
nheassgvssacpylgkssffrnvvwlikknsayptikrsynntnqedllvlwgihhpnd
aaeqtklyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmeffwtilkpndainfes
ngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihpltigecp
kyvksnrlvlatglrnt

SCOPe Domain Coordinates for d3s12a1:

Click to download the PDB-style file with coordinates for d3s12a1.
(The format of our PDB-style files is described here.)

Timeline for d3s12a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3s12a2
View in 3D
Domains from other chains:
(mouse over for more information)
d3s12b_