![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
![]() | Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
![]() | Protein automated matches [190916] (13 species) not a true protein |
![]() | Species Solanum lycopersicum [TaxId:4081] [196089] (6 PDB entries) |
![]() | Domain d3s0pg_: 3s0p G: [249259] automated match to d3hoga_ complexed with cu |
PDB Entry: 3s0p (more details), 3 Å
SCOPe Domain Sequences for d3s0pg_:
Sequence, based on SEQRES records: (download)
>d3s0pg_ b.1.8.1 (G:) automated matches {Solanum lycopersicum [TaxId: 4081]} tkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmstg ahfnpnklthgapgdeirhagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvhe leddlgkgghelslttgnaggrlacgvvgltpi
>d3s0pg_ b.1.8.1 (G:) automated matches {Solanum lycopersicum [TaxId: 4081]} tkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmstg ahfnagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvheledaggrlacgvvgl tpi
Timeline for d3s0pg_: