SCOPe 2.08: Domain d3s0pe_: 3s0p E:

Lineage for d3s0pe_ (3s0p E:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein automated matches [190916] (13 species)
   not a true protein

7. Species Solanum lycopersicum [TaxId:4081] [196089] (6 PDB entries)

8. Domain d3s0pe_: 3s0p E: [249257]
   automated match to d3hoga_
   complexed with cu

Details for d3s0pe_

PDB Entry: 3s0p, 3 Å

PDB Description: Copper-reconstituted Tomato Chloroplast Superoxide Dismutase

PDB Compounds: (E:) Superoxide dismutase [Cu-Zn], chloroplastic

SCOPe Domain Sequences for d3s0pe_:

Sequence, based on SEQRES records:

>d3s0pe_ b.1.8.1 (E:) automated matches {Solanum lycopersicum [TaxId: 4081]}
tkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmstg
ahfnpnklthgapgdeirhagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvhe
leddlgkgghelslttgnaggrlacgvvgltpi

Sequence, based on observed residues (ATOM records):

>d3s0pe_ b.1.8.1 (E:) automated matches {Solanum lycopersicum [TaxId: 4081]}
tkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmstg
ahfnpagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvheledggrlacgvvgl
tpi

Timeline for d3s0pe_:

• d3s0pe_ first appeared in SCOPe 2.04
  
• d3s0pe_ appears in SCOPe 2.07