Lineage for d3rzok_ (3rzo K:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1656918Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1657041Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 1657142Family d.74.3.2: RBP11/RpoL [64311] (3 proteins)
  6. 1657177Protein automated matches [190337] (2 species)
    not a true protein
  7. 1657184Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256070] (1 PDB entry)
  8. 1657185Domain d3rzok_: 3rzo K: [249253]
    Other proteins in same PDB: d3rzoa_, d3rzob_, d3rzoe1, d3rzoe2, d3rzof_, d3rzoh_, d3rzoi1, d3rzoi2, d3rzoj_, d3rzol_
    automated match to d1twfk_
    protein/DNA complex; protein/RNA complex; complexed with zn

Details for d3rzok_

PDB Entry: 3rzo (more details), 3 Å

PDB Description: rna polymerase ii initiation complex with a 4-nt rna
PDB Compounds: (K:) DNA-directed RNA polymerase II subunit RPB11

SCOPe Domain Sequences for d3rzok_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rzok_ d.74.3.2 (K:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOPe Domain Coordinates for d3rzok_:

Click to download the PDB-style file with coordinates for d3rzok_.
(The format of our PDB-style files is described here.)

Timeline for d3rzok_: