Lineage for d3rzoi2 (3rzo I:50-120)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641064Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families) (S)
  5. 2641065Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins)
  6. 2641144Protein automated matches [254700] (2 species)
    not a true protein
  7. 2641154Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256069] (1 PDB entry)
  8. 2641156Domain d3rzoi2: 3rzo I:50-120 [249251]
    Other proteins in same PDB: d3rzoa_, d3rzob_, d3rzoe1, d3rzoe2, d3rzof_, d3rzoh_, d3rzoj_, d3rzok_, d3rzol_
    automated match to d1i50i2
    protein/DNA complex; protein/RNA complex; complexed with zn

Details for d3rzoi2

PDB Entry: 3rzo (more details), 3 Å

PDB Description: rna polymerase ii initiation complex with a 4-nt rna
PDB Compounds: (I:) DNA-directed RNA polymerase II subunit RPB9

SCOPe Domain Sequences for d3rzoi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rzoi2 g.41.3.1 (I:50-120) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknkrtq

SCOPe Domain Coordinates for d3rzoi2:

Click to download the PDB-style file with coordinates for d3rzoi2.
(The format of our PDB-style files is described here.)

Timeline for d3rzoi2: