Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily) core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) automatically mapped to Pfam PF01191 |
Family d.78.1.0: automated matches [254302] (1 protein) not a true family |
Protein automated matches [254702] (3 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256076] (1 PDB entry) |
Domain d3rzoe2: 3rzo E:144-215 [249247] Other proteins in same PDB: d3rzoa_, d3rzob_, d3rzoe1, d3rzof_, d3rzoh_, d3rzoi1, d3rzoi2, d3rzoj_, d3rzok_, d3rzol_ automated match to d1dzfa2 protein/DNA complex; protein/RNA complex; complexed with zn |
PDB Entry: 3rzo (more details), 3 Å
SCOPe Domain Sequences for d3rzoe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rzoe2 d.78.1.0 (E:144-215) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse tsgryasyricm
Timeline for d3rzoe2: