Lineage for d3rzoe1 (3rzo E:2-143)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136225Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2136828Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) (S)
  5. 2136829Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins)
  6. 2136862Protein automated matches [254701] (3 species)
    not a true protein
  7. 2136867Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256068] (1 PDB entry)
  8. 2136868Domain d3rzoe1: 3rzo E:2-143 [249246]
    Other proteins in same PDB: d3rzoa_, d3rzob_, d3rzoe2, d3rzof_, d3rzoh_, d3rzoi1, d3rzoi2, d3rzoj_, d3rzok_, d3rzol_
    automated match to d1dzfa1
    protein/DNA complex; protein/RNA complex; complexed with zn

Details for d3rzoe1

PDB Entry: 3rzo (more details), 3 Å

PDB Description: rna polymerase ii initiation complex with a 4-nt rna
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III subunit RPABC1

SCOPe Domain Sequences for d3rzoe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rzoe1 c.52.3.1 (E:2-143) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
dqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfq
anpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsam
klvpsippatietfneaalvvn

SCOPe Domain Coordinates for d3rzoe1:

Click to download the PDB-style file with coordinates for d3rzoe1.
(The format of our PDB-style files is described here.)

Timeline for d3rzoe1: