Lineage for d3rw7c1 (3rw7 C:117-198)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952471Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2952472Protein automated matches [190896] (11 species)
    not a true protein
  7. 2952511Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)
  8. 2952609Domain d3rw7c1: 3rw7 C:117-198 [249241]
    Other proteins in same PDB: d3rw7a2, d3rw7b_, d3rw7c2, d3rw7d_
    automated match to d1kooa2

Details for d3rw7c1

PDB Entry: 3rw7 (more details), 3 Å

PDB Description: Structure of N-terminal domain of nuclear RNA export factor TAP
PDB Compounds: (C:) nuclear RNA export factor 1

SCOPe Domain Sequences for d3rw7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rw7c1 d.58.7.0 (C:117-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
knwfkitipygrkydkawllsmiqskcsvpftpiefhyentraqffvedastasalkavn
ykildrenrrisiiinssapph

SCOPe Domain Coordinates for d3rw7c1:

Click to download the PDB-style file with coordinates for d3rw7c1.
(The format of our PDB-style files is described here.)

Timeline for d3rw7c1: