| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
| Family c.10.2.3: mRNA export factor tap [52065] (2 proteins) this is a repeat family; one repeat unit is 1fo1 A:248-278 found in domain |
| Protein automated matches [254723] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [256067] (1 PDB entry) |
| Domain d3rw7b_: 3rw7 B: [249240] Other proteins in same PDB: d3rw7a1, d3rw7c1 automated match to d1kohb_ |
PDB Entry: 3rw7 (more details), 3 Å
SCOPe Domain Sequences for d3rw7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rw7b_ c.10.2.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elkpeqveqlklimskrydgsqqaldlkglrsdpdlvaqnidvvlnrrscmaatlriiee
nipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwl
dgnslcdtfrdqstyisairerfpkllrldghelpppiaf
Timeline for d3rw7b_: