Lineage for d3rurd_ (3rur D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1771461Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 1771507Family b.1.28.0: automated matches [195425] (1 protein)
    not a true family
  6. 1771508Protein automated matches [195426] (5 species)
    not a true protein
  7. 1771522Species Staphylococcus aureus [TaxId:158879] [233500] (7 PDB entries)
  8. 1771530Domain d3rurd_: 3rur D: [249220]
    automated match to d3rtlb_
    complexed with hem, mg

Details for d3rurd_

PDB Entry: 3rur (more details), 1.7 Å

PDB Description: staphylococcus aureus heme-bound selenomethionine-labeled isdb-n2
PDB Compounds: (D:) Iron-regulated surface determinant protein B

SCOPe Domain Sequences for d3rurd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rurd_ b.1.28.0 (D:) automated matches {Staphylococcus aureus [TaxId: 158879]}
skmtdlqdtkyvvyesvennesmmdtfvkhpiktgmlngkkymvmettnddywkdfmveg
qrvrtiskdaknntrtiifpyvegktlydaivkvhvktidydgqyhvrivdkeaf

SCOPe Domain Coordinates for d3rurd_:

Click to download the PDB-style file with coordinates for d3rurd_.
(The format of our PDB-style files is described here.)

Timeline for d3rurd_: