Lineage for d3rurc1 (3rur C:341-456)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766795Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 2766841Family b.1.28.0: automated matches [195425] (1 protein)
    not a true family
  6. 2766842Protein automated matches [195426] (7 species)
    not a true protein
  7. 2766861Species Staphylococcus aureus [TaxId:158879] [233500] (8 PDB entries)
  8. 2766869Domain d3rurc1: 3rur C:341-456 [249219]
    Other proteins in same PDB: d3rurb2, d3rurc2, d3rurd2
    automated match to d3rtlb_
    complexed with hem, mg

Details for d3rurc1

PDB Entry: 3rur (more details), 1.7 Å

PDB Description: staphylococcus aureus heme-bound selenomethionine-labeled isdb-n2
PDB Compounds: (C:) Iron-regulated surface determinant protein B

SCOPe Domain Sequences for d3rurc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rurc1 b.1.28.0 (C:341-456) automated matches {Staphylococcus aureus [TaxId: 158879]}
kmtdlqdtkyvvyesvennesmmdtfvkhpiktgmlngkkymvmettnddywkdfmvegq
rvrtiskdaknntrtiifpyvegktlydaivkvhvktidydgqyhvrivdkeaftk

SCOPe Domain Coordinates for d3rurc1:

Click to download the PDB-style file with coordinates for d3rurc1.
(The format of our PDB-style files is described here.)

Timeline for d3rurc1: