Lineage for d3rura_ (3rur A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1525010Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 1525052Family b.1.28.0: automated matches [195425] (1 protein)
    not a true family
  6. 1525053Protein automated matches [195426] (5 species)
    not a true protein
  7. 1525067Species Staphylococcus aureus [TaxId:158879] [233500] (7 PDB entries)
  8. 1525072Domain d3rura_: 3rur A: [249217]
    automated match to d3rtlb_
    complexed with hem, mg

Details for d3rura_

PDB Entry: 3rur (more details), 1.7 Å

PDB Description: staphylococcus aureus heme-bound selenomethionine-labeled isdb-n2
PDB Compounds: (A:) Iron-regulated surface determinant protein B

SCOPe Domain Sequences for d3rura_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rura_ b.1.28.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
kmtdlqdtkyvvyesvennesmmdtfvkhpiktgmlngkkymvmettnddywkdfmvegq
rvrtiskdaknntrtiifpyvegktlydaivkvhvktidydgqyhvrivdkeaft

SCOPe Domain Coordinates for d3rura_:

Click to download the PDB-style file with coordinates for d3rura_.
(The format of our PDB-style files is described here.)

Timeline for d3rura_: