| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
| Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins) |
| Protein Biotin carboxylase (BC), domain 2 [56068] (2 species) subunit of acetyl-CoA and pyruvate carboxylases |
| Species Escherichia coli [TaxId:562] [56069] (24 PDB entries) |
| Domain d3rupb2: 3rup B:115-330 [249215] Other proteins in same PDB: d3rupa1, d3rupa3, d3rupa4, d3rupb1, d3rupb3, d3rupb4 automated match to d1dv2a3 complexed with adp, ca, cl |
PDB Entry: 3rup (more details), 1.99 Å
SCOPe Domain Sequences for d3rupb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rupb2 d.142.1.2 (B:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq
vehpvtemitgvdlikeqlriaagqplsikqeevhv
Timeline for d3rupb2:
View in 3DDomains from other chains: (mouse over for more information) d3rupa1, d3rupa2, d3rupa3, d3rupa4 |