SCOPe 2.05: Domain d3ru6b_: 3ru6 B:

Lineage for d3ru6b_ (3ru6 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.0: automated matches [191350] (1 protein)
   not a true family

6. Protein automated matches [190292] (26 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [194783] (3 PDB entries)

8. Domain d3ru6b_: 3ru6 B: [249208]
   automated match to d3tfxa_
   complexed with cl, iod

Details for d3ru6b_

PDB Entry: 3ru6, 1.8 Å

PDB Description: 1.8 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase (pyrf) from campylobacter jejuni subsp. jejuni nctc 11168

PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3ru6b_:

Sequence, based on SEQRES records:

>d3ru6b_ c.1.2.0 (B:) automated matches {Campylobacter jejuni [TaxId: 192222]}
amklcvaldlstkeeclqlakelknldiwlkvglraylrdgfkfieelkkvddfkifldl
kfhdipntmadaceevsklgvdminihasagkiaiqevmtrlskfskrplvlavsaltsf
deenffsiyrqkieeavinfskisyengldgmvcsvfeskkikehtssnfltltpgirpf
getnddqkrvanlamarenlsdyivvgrpiyknenpravcekilnkih

Sequence, based on observed residues (ATOM records):

>d3ru6b_ c.1.2.0 (B:) automated matches {Campylobacter jejuni [TaxId: 192222]}
amklcvaldlstkeeclqlakelknldiwlkvglraylrdgfkfieelkkvddfkifldl
kfhdipntmadaceevsklgvdminihasagkiaiqevmtrlskfskrplvlavsaltsf
deenffsiyrqkieeavinfskisyengldgmvcsvfeskkikehtssnfltltpgirpf
getvanlamarenlsdyivvgrpiyknenpravcekilnkih

Timeline for d3ru6b_:

• d3ru6b_ first appeared in SCOPe 2.04
  
• d3ru6b_ is called d3ru6b1 in SCOPe 2.06
  
• d3ru6b_ appears in the current release, SCOPe 2.08, called d3ru6b1